PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lj3g3v3556020.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Loteae; Lotus
Family NAC
Protein Properties Length: 314aa    MW: 35799.7 Da    PI: 6.6364
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lj3g3v3556020.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM154.74.1e-48161432128
              NAM   2 ppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk 95 
                       pGfrFhPt+eel+++yLk+ v+gkkl++ +vi  ++iy+++PwdLp   k +e+ewyfF++rdkk+ +g r+nr+t++g+Wkatg+d+++++ 
  Lj3g3v3556020.1  16 LPGFRFHPTEEELLDFYLKNMVAGKKLRF-DVIGFLNIYHHDPWDLPGLSKVGEREWYFFVPRDKKHGSGGRPNRTTEKGFWKATGSDRKIVTL 108
                      59*************************99.99***************8778899*************************************987 PP

              NAM  96 ..kgelvglkktLvfykgrapkgektdWvmheyrl 128
                         ++ +gl+ktLvfy+grap+g+ktdWvm+eyrl
  Lj3g3v3556020.1 109 sdPKRIIGLRKTLVFYQGRAPRGSKTDWVMNEYRL 143
                      666778***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019412.09E-5613161IPR003441NAC domain
PROSITE profilePS5100554.45315161IPR003441NAC domain
PfamPF023659.0E-2617143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009965Biological Processleaf morphogenesis
GO:0010200Biological Processresponse to chitin
GO:0045792Biological Processnegative regulation of cell size
GO:0048281Biological Processinflorescence morphogenesis
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 314 aa     Download sequence    Send to blast
MASMEDMNNI TEETALPGFR FHPTEEELLD FYLKNMVAGK KLRFDVIGFL NIYHHDPWDL  60
PGLSKVGERE WYFFVPRDKK HGSGGRPNRT TEKGFWKATG SDRKIVTLSD PKRIIGLRKT  120
LVFYQGRAPR GSKTDWVMNE YRLPDNCRLP KDIVLCKIYR KATSLKVLEQ RAALEEEMKQ  180
FGSSPASPPS STDTMSFTHE DQNIMSLPLF QDVVLKKESE AEAENEEMML SMSMSVPKQE  240
KSQTQLVFND SNKSTCGGGG SSLQLPLGND KLPELQLPMV TDWTTQLTQD TFWAHLNSPW  300
LQNLTPSSIL NFHS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A3e-461716117168Stress-induced transcription factor NAC1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Lja.22470.0pod| root
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0986511e-177BT098651.1 Soybean clone JCVI-FLGm-23E20 unknown mRNA.
GenBankDQ0287741e-177DQ028774.1 Glycine max NAC domain protein NAC6 (NAC6) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001236900.11e-173NAC domain protein NAC6
TrEMBLA0A0B2PD841e-175A0A0B2PD84_GLYSO; Putative NAC domain-containing protein 94
TrEMBLI1LPE91e-175I1LPE9_SOYBN; Uncharacterized protein
STRINGGLYMA12G02540.11e-175(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF62143251
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17040.11e-110NAC domain containing protein 36